Introducing APO-PERINDOPRIL / AMLODIPINE TABLETS

  • Pdf File 1,070.85KByte

For pharmacist use only.

Viacoram 14 mg / 10 mg Tabs actual size

Viacoram 7 mg / 5 mg Tabs actual size

Viacoram 3.5 mg / 2.5 mg Tabs actual size

Code: NC/Aode: N/CAoRdeev:#: N0/ARev#: 0 Rev#: 0 SeeCMoaftAer: iaSleSepMecaitfiecraiatSiloeSnepCeMceairfitiecfiracitaaiolteSnpoCefecAritfinificacalyatsitoiesnoCf eArntiafilcyasties of Analysis 750096 750096

Pantone Colours:

Pantone Pantone Colour0s:32 C Colour0s3:23C00 C 0323C000C12 C

300ViColBeltaCck

BlacBklackDIELINE DIELDIINEELINUAEQVUVEAORUNSUAISQVCHUOUAVE/AQAVOTRUVUINENASOIGRSUCNHOSIS/ACHTOIN/AGTINGCPOERLOCEUNRTCPAOEGRLCPEOCEOEURLNROCTEUANRGTEAGE

750096

Dimensions/Dimeliennes#i:on5s/0DD.i8iemlminenem#si:oxn51s0/3D.88ie.1mli2nme5#m:x m15308.(8.21m2P5mlym)xm138(2.1P2l5y)mm (2 Ply)

K&F CODE 161695

Minimum Minimum MinimuPmrepared by:PrMepAaDreHdAbVyA: PCrMHeApARaDrYHedAVbAy:CHMAARDYHAVA CHARY Font Size: 7FoPnTt Size: 7FPonTt SizDea:te:7 PT DaJtUe:N 08, 20D1J8aUteN: 08, 2018JUN 08, 2018

PAGE 1 OF 1 PAGE 1 OF 1 PAGE 1 OF 1

161697

161698

141039

141040

MCKESSON CODE 141005

Apo-Perindopril / Amlodipine 14 mg / 10 mg Tabs actual size

Apo-Perindopril / Amlodipine 7 mg / 5 mg Tabs actual size

Apo-Perindopril / Amlodipine 3.5 mg / 2.5 mg Tabs actual size

PRODUCT COMPARISON

For more information or to place orders, please contact your Apotex Sales Representative or our National Order Desk at:

1.877.427.6839

Introducing

APO-PERINDOPRIL / AMLODIPINE TABLETS

The first generic alternative to Viacoram

View 1 / VFrieownt1pa/nFVeriolenwt p1a/nFerlont panel

non-varnish arneoan-varnish arenaon-varnish area

22.225 mm x 5202.822m5mmm x 5202.8.2m2252m.m22m5 xm5m0.8 restricted arearfeosrtricted area rfeosrtricted area for

2m2m.225

mm

Lot and ExpiryLeontcaonddinEgxpiry LeontcoanddingExpiry encoding

22.225 mm

138.125 mm 138.125 mm 138.125 mm 115.9 mm 115.9 mm 115.9 mm

APO CODE 66251 66211 66253

50.8 mm 50.8 mm

Angiotensin coAnvgeiortienngsin 1c0oA0nnvTgeaibrotlitenetgsns/iCno1cm0o0pnrTviamebr?ltesintsg/ enzyme inhibietonrzy/me inhibiteonrz/yme inhibitor /

CoD1mI0Np0r0Tim2ab4?l6se8ts5/6CDo5ImNpId0rnie2mh4ci?b6osin8tev5ue7rrsd3DieoINnlId'nde0ehen2ciz4boy6imnt8eveue5rr8sdPTi1ieorneell'zIdenHIencheziciryboemint/evuerrPTsdiieeoreenlz'dHeIceneizreym/ e

Peel Here / Tirez Ici

DcaihlcyidurmopaynritdaignDcoeainhlicysidturmopaynritdaignoADcenaiPhilscOytidu-rmPopEayRnritIdaNignADoenPOiOsPt-RPIELR/AINMDALOPOOPD-RIPPIELI/RNAIEMNDLld'OeanPDlgaRIiPocIltLIeaNn/sAssEeiMndeeLld/'seaOanndlDgatiahiIocgPyltodeaInrsNoissspEeitnyederided/lus'iaencndelatigaashlicgyociodulteanrmnsoisspteiyenrdeiddeu/isancndeatislahcgyiuodmnroisptyeridduinceaslcium

Viacoram

Viacoram

Viacoram

BRAND REFERENCE

50.8 mmPwIbPnehrifottoawhtrrememCceotaannftcri1sioosu5mntm?:.CDleSiPwIbP-girntseohrh3ifopttorat0wheterra?ememnCCnces.odtaanenftcri1sioosu5mntm?:.CDlPeSi-gierPwIbPtsnoh3rehrpiifrto0ttCnoaeewhat?dorrenCnmemoCmcs.depoteaapn3rnftcririli1s.ioomsau55mntrm?:.geCsPDliemStined-girdtirseoh3n'igpaCnrte0peemdoa?eanCom/nlrnspo.idpnde2rdridilai.pommai75pnr?rlgeoislPimtdndaedieprrn'ggaiieCnpnimndeoea/ilormnnoitpnad5edprdbiria1ploimemmipa4ntrrls?eoigegsldimtnadidpirePadcCn'gigaovehoneipmnenseaneaicts/rslrnitnomoinealend1dmer?badvisals0pmcoeemriipartneeasrulemenntoixnlesd:taueigrPadcCDprreigosvegiho?n1i.ensnanlne5ictsersiviomnntem?lraemere?Cabvesrsmcleneriartteetasusenntxnes:tuerDrePadcCisg?oveho1.nlensan5iectsvrsim?omrneleCmer?earvssenmcettriarseeauenntxnes:tuerDreisg?1.nl5ievm?reCerentts

moisture. Questions

or

moisture. cQounecsetrinosn?s

or

cmQonuAoceniessttirtuhniorysenp?.seroter ncsoAinvncetei/rhnAyspn?etirhtyepnesriAvteennt/ishAeyunprteihrtyepnesr3lituve0men?si/C?eAr.uenPrteriothtdy?epgeel'3lrrhut0uedmmne?iCs?liaedr.euiPt?rer.ot td?egel'rh3luud0mme?ilCi?adr.ietP?er.ot td?egel'rhudme liadit?.

1-800-667-47018-800-667-47018-800-667-4708

Des questionsDoeus questions Doues questions ou

Code No. KR. DRUGS/KCToKd/2e5N/5o2. 1K/R2.0D06RUGS/KTCKo/d2e5/N5o2.1K/2R0.0D6RUGS/KTK/25/521/2006

397097

397144

397174

probl?mes ? probl?mes ? probl?mes ?

TORONTO CANADA

1-80TC0OAR-N6OAN6DT7OA-47018-80TC0OA-RN6OA6ND7TOA-47018-800-667-4708

3.175 mm 3.175 mm (.125") C.R. (.125") C.R. Non Printing Non Printing

Die Line Die Line

3.175 mm (.125") C.R. Non Printing

Die Line

ALL COPY SHOALULLDCOBPEY3S.1H7O5AULmLLmDCBO(.EP12Y35.S1")7H5OUmLmD (B.1E235."1)75 mm (.125") AWAY FROM EADWGAEYOFFRDOIME LEIADNWGEEABYOUFTRDGOIREMALPEINHDEIGCEBSUOCTFAGDNRIEBALLPEIHNEIDECSBOUFCFTANGRBALPEHEDICOSFCFAN BLEED OFF

UPC 771313248167 771313248174 771313248181

100 BTL

100 BTL

100 BTL

PACK SIZE(S)

ORDERING INFORMATION

02468581

02468573

02468565

DIN

PRODUCT INFORMATION

Apo-Perindopril / Amlodipine 14 mg / 10 mg Tabs

Apo-Perindopril / Amlodipine 7 mg / 5 mg Tabs

Apo-Perindopril / Amlodipine 3.5 mg / 2.5 mg Tabs

Apo-Perindopril / Amlodipine 14 mg / 10 mg Tabs

Apo-Perindopril / Amlodipine 7 mg / 5 mg Tabs

Apo-Perindopril / Amlodipine 3.5 mg / 2.5 mg Tabs

View 2 / VBiaecwk f2ac/ eBVaoiecfwkfrfo2anc/teBpoaafcnkferolfanctepoafnefrlont panel

138.125 mm 138.125 mm 138.125 mm 115.9 mm 115.9 mm 115.9 mm

22.225 mm 22.225 mm 22.225 mm

PRODUCT

PRODUCT

PERMANENT G PERMANENT G PERMANENT G

Each tablet coEnatacihnsta3b.l5etmcgonEptaecrinihnsdta7obpmlreigtl caporegnritinnaiidnnoespa1rni4ldam2rg.5inpmienrgeinaodnfodapm5rilmoadrgigpoiinnfienameasalonaddmip1lio0ndemipagisnoeafmbaelmosdyloilpadtiniep.einbeesayslatme.lodipine besylate. Adult dose: TaAbdleutlst dshooseu:ldTabAbeldesutwsltasdllhoowsueel:dTbwaebhlsoewltesawlslohitwohuealdgwblaehsoslweoafwlwliotahwteardgpwlarehsfsoelroeafwbwliytahtaetartghpleraesfsearmoafbewlytiamatteerthepearceshfaemraebltyimaet tehaechsame time each day, in the modrnayin,gin. Tthakeemboerdfnoairyne,gai.nTmtahekeaelm.bSeoefroenriePnrgao.mdTuaeckatel.MbSeoefneoorPgerroaadpmuhec,atalMv. aSoilenaeobgPleraopdnhur,ceatqvMuaeiolsantb.olUgersoaenpthrh,eisqavuaeislat.bUlesoenthriesquest. Use this medication asmdierdeicctaetdiobnyaysomduireedpcihctyeasdtiocbinyanaysoaundrdirpephchtyaesrdimcbiaycnyisaotnu.drKepehpayrsomicuaitaconifsatr.neKdacephehpanormdutasocigfishrtte.aoKcfehcehpainlodurest niog.fhrteoafcchhailnddresnig. ht of children.

Chaque comprCimha?qcuoenctoiemntp3rCi,m5ha?mqcugoendcteioepmnetrp7irnimdog?pcrdioel naptreigerininntidn1oe4pemrtil2ga,5rdgeminpgienrdein'eadtmo5plomrdiligparidng'eainmsinoloeudseitpfo1inr0memseogdueds'afomrmloedidpeinbe?ssoyulasteforme de

50.8 mm 50.8 mm 50.8 mm

b?sylate d'amldo'damipilnoed.ipPinoes.oPIboo?gsiyoelIaocthgeeidez'acI'mhaedlozudIl'tiapedin:ueLl.teePso:csLooemIsopcgroimemc?phsreidmzo?Ii'vsaednuotli?vteterne:tLa?evtsarelc?aosvmeanpl?resimnet?inesrednaovtiievcreanuvtne?ctruenavaelr?rse en entier avec un

Copyright ? 2019 Apotex Inc. Viacoram is a trademark of Servier Canada Inc.

OTHER RECENT PRODUCT LAUNCHES

PRODUCT

Apo-Amphetamine XR 5 mg Caps Apo-Amphetamine XR 10 mg Caps Apo-Amphetamine XR 15 mg Caps Apo-Amphetamine XR 20 mg Caps Apo-Amphetamine XR 25 mg Caps Apo-Amphetamine XR 30 mg Caps

Bortezomib 3.5 mg Injectable (Vial)

Apo-Acyclovir 5% w/w Ointment Apo-Acyclovir 5% w/w Ointment Apo-Dabigatran 75 mg Caps Apo-Dabigatran 110 mg Caps Apo-Dabigatran 150 mg Caps Apo-Vardenafil 5 mg Tabs Apo-Vardenafil 10 mg Tabs Apo-Vardenafil 20 mg Tabs Apo-Midodrine 2.5 mg Tabs Apo-Midodrine 5 mg Tabs Apo-Travoprost-Timop 0.004%/0.5% Ophthalmic Solution Apo-Ambrisentan 5 mg Tabs Apo-Ambrisentan 10 mg Tabs Melphalan for Injection 50 mg/vial Apo-HYDROmorphone CR 3 mg Caps Apo-HYDROmorphone CR 4.5 mg Caps Apo-HYDROmorphone CR 6 mg Caps Apo-HYDROmorphone CR 9 mg Caps Apo-HYDROmorphone CR 12 mg Caps Apo-HYDROmorphone CR 18 mg Caps Apo-HYDROmorphone CR 24 mg Caps Apo-HYDROmorphone CR 30 mg Caps Apo-Pinaverium 50 mg Tabs Apo-Pinaverium 100 mg Tabs

PACK SIZE(S) 100 BTL 100 BTL 100 BTL 100 BTL 100 BTL 100 BTL 1 Single Use Vial 4 g Tube 30 g Tube 30 BLS 60 BTL 60 BTL 4 BLS 4 BLS 4 BLS 100 BTL 100 BTL

5 mL

30 BLS 30 BLS 1 Kit 60 BTL 60 BTL 60 BTL 60 BTL 60 BTL 60 BTL 60 BTL 60 BTL 100 BTL 100 BTL

DIN

02445492 02445506 02445514 02445522 02445530 02445549

02456176

02477130 02477130 02468891 02468905 02468913 02471647 02471655 02471663 02278677 02278685

02415305

02475375 02475383 02468921 02476614 02476622 02476630 02476649 02476657 02476665 02476673 02476681 02469677 02469685

BRAND REFERENCE1 Adderall XR Adderall XR Adderall XR Adderall XR Adderall XR Adderall XR

Velcade

Zovirax Zovirax Pradaxa Pradaxa Pradaxa Levitra Levitra Levitra Amatine Amatine

DuoTrav

Volibris Volibris Alkeran Hydromorph Contin Hydromorph Contin Hydromorph Contin Hydromorph Contin Hydromorph Contin Hydromorph Contin Hydromorph Contin Hydromorph Contin Dicetel Dicetel

APO CODE 55644 55645 55646 55647 55648 55649

63284

66784 66785 65450 65451 65452 66929 66930 66931 48149 48148

61665

65773 65774 65119 53046 66644 53050 66689 53051 53052 53053 53054 47840 47839

MCKESSON CODE 140258 140255 140256 140253 140254 140257

139529

138756 138769 137470 137469 137468 135622 135653 135623 135687 135688

135545

135154 135155 135049 132982 133024 132983 132981 133004 133002 133023 133022 132066 132067

K&F CODE 161571 161572 161575 161573 161574 161576

161541

161461 161462 161280 161281 161282 161059 161060 161061 119102 119103

161062

161016 161015 160996 160783 160787 160789 160790 160780 160782 160792 160785 160614 160617

TM

Copyright ? 2019 Apotex Inc. 1Brand references are the trademarks of third party manufacturers.

For more information or to place orders, please contact your Apotex Sales Representative or our National Order Desk at:

1.877.427.6839

For pharmacist use only.

................
................

Online Preview   Download